hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpm/mpm04328/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0765 ( 569 res) mpm04328 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or 60.9 2.8e-14 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RRM_1 1/2 343 413 .. 1 74 [] 34.7 2.1e-06 RRM_1 2/2 457 527 .. 1 74 [] 26.9 0.00023 Alignments of top-scoring domains: RRM_1: domain 1 of 2, from 343 to 413: score 34.7, E = 2.1e-06 *->lfVgNLppdtteedLkdlFskfGpi.esikivrDttretgrskGfaF ++ ++Lp+++ + + d+F+k ++ si i + +g+ G +F mKIAA0765 343 VYLKGLPFEAENKHVIDFFKKLDIVeDSIYIAYG---PNGKATGEGF 386 VeFedeedAekAldalnGkelggrelrv<-* VeF + d ++Al ++++ g+r + v mKIAA0765 387 VEFRNDADYKAALC-RHKQYMGNRFIQV 413 RRM_1: domain 2 of 2, from 457 to 527: score 26.9, E = 0.00023 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV ++N+p+++t+ d+ ++ + ++ e++ v ++g+ G a V mKIAA0765 457 AHITNIPFSITKMDVLQFLEGIPVDENAVHVLV--DNNGQGLGQALV 501 eFedeedAekAldalnGkelggrelrv<-* +F++e+dA k l+ k+l+gre v mKIAA0765 502 QFKTEDDAHKSEH-LHRKKLNGREAFV 527 //