hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mej/mej02120/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0737 ( 627 res) mej02120 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HMG DNA-binding domain, high mobility group prot 76.8 2.6e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HMG 1/1 230 300 .. 1 71 [] 76.8 2.6e-18 Alignments of top-scoring domains: HMG: domain 1 of 1, from 230 to 300: score 76.8, E = 2.6e-18 *->kpKrPmsafmlFsqenRakikkenPdlknaeisKklgerWkeLseee p +P sa+ lF + a ik +nP+++++e+sK+++ +W L ee+ mKIAA0737 230 EPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ 276 KapYeekAekdkeryekempeykk<-* K+ Y+ k e++k++y k++++yk mKIAA0737 277 KQVYKRKTEAAKKEYLKALAAYKD 300 //