hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpm/mpm06380/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0733 ( 685 res) mpm06380 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CUE Domain that may be involved in binding ubiqu 44.0 2e-08 1 ZnF_RBZ Zinc finger domain 39.5 4.5e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CUE 1/1 1 42 [. 1 43 [] 44.0 2e-08 ZnF_RBZ 1/1 658 682 .. 1 25 [] 39.5 4.5e-07 Alignments of top-scoring domains: CUE: domain 1 of 1, from 1 to 42: score 44.0, E = 2e-08 *->eneealsqlkemFPnldeevIeavLeantgnveatinnLLegs<-* ++l++l++ FP+++e+v+++++++n++n++a++++L ++s mKIAA0733 1 -DFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQES 42 ZnF_RBZ: domain 1 of 1, from 658 to 682: score 39.5, E = 4.5e-07 *->gdWeCpaCtflNfasrskCfaCgap<-* +W+C+aCtflN++ ++C++C+ p mKIAA0733 658 AQWNCTACTFLNHPALIRCEQCEMP 682 //