hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbh/mbh00867/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0696 ( 555 res) mbh00867 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- WD40 WD40 repeats 231.9 5.3e-65 7 FBOX A Receptor for Ubiquitination Targets 35.2 9e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FBOX 1/1 141 180 .. 1 41 [] 35.2 9e-06 WD40 1/7 242 279 .. 1 46 [] 24.8 0.012 WD40 2/7 282 319 .. 1 46 [] 45.6 6.6e-09 WD40 3/7 322 359 .. 1 46 [] 34.6 1.4e-05 WD40 4/7 365 402 .. 1 46 [] 37.6 1.7e-06 WD40 5/7 405 442 .. 1 46 [] 38.9 7e-07 WD40 6/7 445 482 .. 1 46 [] 37.8 1.5e-06 WD40 7/7 494 531 .. 1 46 [] 29.6 0.00042 Alignments of top-scoring domains: FBOX: domain 1 of 1, from 141 to 180: score 35.2, E = 9e-06 *->LPieileeIlskLdpkdllrlrkVsrkwrslidshdfwfkr<-* L +i e+Ils+Ld+++l+++ +V++ w ++i++ +w+k+ mKIAA0696 141 LD-HIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKL 180 WD40: domain 1 of 7, from 242 to 279: score 24.8, E = 0.012 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + + ++ + ++ +V+++++++d ++sg +D++i++W mKIAA0696 242 NlQRIQCRSENSK--GVYCLQYDDD--------KIISGLrDNSIKIW 278 d<-* d mKIAA0696 279 D 279 WD40: domain 2 of 7, from 282 to 319: score 45.6, E = 6.6e-09 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + ++l++l+gHtg +V++++++ ++++gs+D+t+r+W mKIAA0696 282 SlECLKVLTGHTG--SVLCLQYDER--------VIVTGSsDSTVRVW 318 d<-* d mKIAA0696 319 D 319 WD40: domain 3 of 7, from 322 to 359: score 34.6, E = 1.4e-05 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW t+++l tl H+ +V++++fs l++++s+D++i +W mKIAA0696 322 TgEVLNTLIHHNE--AVLHLRFSNG--------LMVTCSkDRSIAVW 358 d<-* d mKIAA0696 359 D 359 WD40: domain 4 of 7, from 365 to 402: score 37.6, E = 1.7e-06 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +l r+l gH++ +V+ v+f++ +++s+s+D+ti++W mKIAA0696 365 DiTLRRVLVGHRA--AVNVVDFDDK--------YIVSASgDRTIKVW 401 d<-* + mKIAA0696 402 S 402 WD40: domain 5 of 7, from 405 to 442: score 38.9, E = 7e-07 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW t + +rtl+gH+ ++ ++++ + l++sgs+D+tirlW mKIAA0696 405 TcEFVRTLNGHKR--GIACLQYRDR--------LVVSGSsDNTIRLW 441 d<-* d mKIAA0696 442 D 442 WD40: domain 6 of 7, from 445 to 482: score 37.8, E = 1.5e-06 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW + +lr+l+gH+ V++++f+ +++sg Dg+i++W mKIAA0696 445 CgACLRVLEGHEE--LVRCIRFDNK--------RIVSGAyDGKIKVW 481 d<-* d mKIAA0696 482 D 482 WD40: domain 7 of 7, from 494 to 531: score 29.6, E = 0.00042 *->t.kllrtlkgHtgespVtsvafspdggssdspnllasgs.DgtirlW ++ +lrtl H+g +V ++f+ +++s+s+D ti +W mKIAA0696 494 StLCLRTLVEHSG--RVFRLQFDEF--------QIISSShDDTILIW 530 d<-* d mKIAA0696 531 D 531 //