hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg01635/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0695 ( 738 res) mbg01635 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CULLIN Cullin 151.7 7.7e-41 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CULLIN 1/1 442 561 .. 1 159 [] 151.7 7.7e-41 Alignments of top-scoring domains: CULLIN: domain 1 of 1, from 442 to 561: score 151.7, E = 7.7e-41 *->dkvlvlFkYiedKDVFekyYkkhLAKRLllnrSaSdDaEenmitkLK dk++++F++i KDVFe++Ykk+LAKRLl ++SaS+DaE++m++kLK mKIAA0695 442 DKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK 488 qecGyPaefTsKLegMFrDislSkdltqsFkdylannpgnaskksiDlsn +y +n++ ++i+l+ mKIAA0695 489 -------------------------------HYMQNQN---VPGNIELT- 503 vrVLtsgyWPtystekikveinLPqeLskaleeFeeFYlakhsGRkLtWl v++Lt gyWPty e++LP+e++k+ e+F++FYl khsGRkL W+ mKIAA0695 504 VNILTMGYWPTYVP----MEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQ 549 hslgsgevkanf<-* lg++ +ka f mKIAA0695 550 STLGHCVLKAEF 561 //