hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj03025/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0689 ( 643 res) mfj03025 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or 122.0 1.1e-32 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RRM_1 1/1 29 100 .. 1 74 [] 122.0 1.1e-32 Alignments of top-scoring domains: RRM_1: domain 1 of 1, from 29 to 100: score 122.0, E = 1.1e-32 *->lfVgNLppdtteedLkdlFskfGpiesikivrDttretgrskGfaFV +fVgN+p+++tee+Lkd+Fs++G+++s+++v+D retg++kG++F+ mKIAA0689 29 VFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYD--RETGKPKGYGFC 73 eFedeedAekAldalnGkelggrelrv<-* e++d+e A +A+++lnG+e+ gr lrv mKIAA0689 74 EYQDQETALSAMRNLNGREFSGRALRV 100 //