hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg02790/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0684 ( 1186 res) mbg02790 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- U-box U-box domain 158.0 1.6e-43 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- U-box 1/1 1111 1184 .. 1 81 [] 158.0 1.6e-43 Alignments of top-scoring domains: U-box: domain 1 of 1, from 1111 to 1184: score 158.0, E = 1.6e-43 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt D+PDEF+DP++++LM+DPV lPSG +++DRs+I+rHLl+ +pt mKIAA0684 1111 DAPDEFRDPLMDTLMTDPVRLPSG-TVMDRSIILRHLLN-----SPT 1151 DPftGRepLthdeliPNleLKekIdafleekrea<-* DPf+ R+ Lt+++l P +eLKe+I+a+++ek+ + mKIAA0684 1152 DPFN-RQMLTESMLEPVPELKEQIQAWMREKQSS 1184 //