hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/meh/meh01005/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0648 ( 1122 res) meh01005 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HEAT HEAT repeat 26.2 0.00074 4 DUP DUP family -32.7 0.44 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HEAT 1/4 73 110 .. 1 36 [] 3.5 79 DUP 1/1 86 186 .. 1 111 [] -32.7 0.44 HEAT 2/4 287 322 .. 1 36 [] 1.6 1.5e+02 HEAT 3/4 402 438 .. 1 36 [] 18.4 0.16 HEAT 4/4 682 718 .. 1 36 [] 3.5 80 Alignments of top-scoring domains: HEAT: domain 1 of 4, from 73 to 110: score 3.5, E = 79 *->e.lldellplllklln.DpdpeVReaAaeaLgalaevl<-* +++l+ l l + + + p+ +VR+ +a +L+++ +++ mKIAA0648 73 QqYLPLALHLASEFFLrNPNKDVRLLVACCLADIFRIY 110 DUP: domain 1 of 1, from 86 to 186: score -32.7, E = 0.44 *->ivlfinvsrclvllvlslflvliflllvvifqfsryislkvkmefkm ++l ++++ v l++ +l+ if ++ + + + +k+k+ f++ mKIAA0648 86 FFLRNPNKD--VRLLVACCLADIFRIYAPEAPYTS--HDKLKDIFLF 128 QlLsEIItekPavdgkeWdtIAynMNqYLF..EnklW.nTpyFFfdGedC It++ ++ + dt +N+Y++ En +W ++ f edC mKIAA0648 129 ------ITRQLKG-LE--DTKSPQFNRYFYllENLAWvKSYNICFELEDC 169 eeFFrklikeplslkks<-* e F l+ +++s+ ++ mKIAA0648 170 NEIFIQLFRTLFSVINN 186 HEAT: domain 2 of 4, from 287 to 322: score 1.6, E = 1.5e+02 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* + ll +++p l l+++d e R+a+++ L++l mKIAA0648 287 QlLL-SVMPQLEFKLKSNDGEERLAVVRLLAKLFGSK 322 HEAT: domain 3 of 4, from 402 to 438: score 18.4, E = 0.16 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* + + d+ll ++ + D+ ++VR+ A L++l++++ mKIAA0648 402 AlVNDQLLGFVRERTLDKRWRVRKEAMMGLAQLYKKY 438 HEAT: domain 4 of 4, from 682 to 718: score 3.5, E = 80 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* + + e + ll++l+ +d++V eaA++ + + ++ mKIAA0648 682 SfHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKI 718 //