hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg01911/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0647 ( 1186 res) mbg01911 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FYVE Protein present in Fab1, YOTB, Vac1, and EEA 119.1 5e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FYVE 1/1 1097 1166 .. 1 81 [] 119.1 5e-31 Alignments of top-scoring domains: FYVE: domain 1 of 1, from 1097 to 1166: score 119.1, E = 5e-31 *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk + ++WvpD++as+C +nC++eF+l ++RrHHCRnCG++fC+ C++ mKIAA0647 1097 TEVTRWVPDHMASHC-FNCDCEFWL-AKRRHHCRNCGNVFCAGCCHL 1141 kaplpklgkekkngknedftpvRVCdsCyerlsk<-* k+p+p+++ ++ pv VC+sCye+++ mKIAA0647 1142 KLPIPDQQLYD---------PVLVCNSCYEHIQV 1166 //