hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg01435/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0645 ( 1570 res) mbg01435 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DEP Domain found in Dishevelled, Egl-10, and Ple 65.7 5.9e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DEP 1/1 1154 1229 .. 1 90 [] 65.7 5.9e-15 Alignments of top-scoring domains: DEP: domain 1 of 1, from 1154 to 1229: score 65.7, E = 5.9e-15 *->pesglklddrkyflktypncFtGselVdWLldnlegqsnngptkttf p++g++l +++ + p cF+ +e+V+WL++n+eg mKIAA0645 1154 PSTGVQLL--SEQKGLSPCCFISAEVVHWLMNNVEG----------- 1187 iidreeAvhlgqaLlkeGlihhvndpnkhtFkdsknalYrFtd<-* +++ ++++ ++q++l+e li h++++ ++tF ++ ++Y++ mKIAA0645 1188 VQTQAMGIDIMQKMLEEQLITHASGEAWRTFIYG-FYFYKIVM 1229 //