hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg20639/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0634 ( 1485 res) mbg20639 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- MACPF membrane-attack complex / perforin 198.9 4.8e-55 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- MACPF 1/1 997 1181 .. 1 232 [] 198.9 4.8e-55 Alignments of top-scoring domains: MACPF: domain 1 of 1, from 997 to 1181: score 198.9, E = 4.8e-55 *->qflvardtVrvrlytvkldesdlplaleFlkalrdLpdqynsanspd +++v++++Vr++ly+vkl +++l+++F+++l+ L+++ +++ mKIAA0634 997 YPMVQQWRVRSNLYRVKLS--TITLSAGFTNVLKILTKESSRD---- 1037 qayarfiddYGTHYitSatlGGeyslllvldkeslerkgwltsediskcl ++ fi++YG HYi++a +G e++++++++++++++++wl++++++++l mKIAA0634 1038 -ELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTEL 1086 ngeakvelassnlvagsvsaemkhctqssssskslstresqtvrlshtqv + ++ + + + + +++ l t + +ls++q mKIAA0634 1087 G--------------SKKELK---SMPFITYLSGLLTAQ----MLSDDQL 1115 lGGaseaievledlergrkgclqsnsldfseWaesvpneaPvlidvksla + G +e+++ +e+gr c+++++l+++ +e++ + Pvl++++++ mKIAA0634 1116 ISG----VEIRC-EEKGR--CPSTCHLCRRPGKEQLSPT-PVLLEINRVV 1157 PiyeLlpespfpvlvaleaspkreaLrqAlesYlk<-* P+y+L++++ ++ea++ Al+s+++ mKIAA0634 1158 PLYTLIQDN-----------GTKEAFKNALMSSYW 1181 //