hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg01462/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0558 ( 1098 res) mbg01462 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Cache_1 Cache domain 133.4 4.1e-36 1 VWA von Willebrand factor type A domain 85.3 1.2e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- VWA 1/1 242 420 .. 1 195 [] 85.3 1.2e-21 Cache_1 1/1 436 525 .. 1 92 [] 133.4 4.1e-36 Alignments of top-scoring domains: VWA: domain 1 of 1, from 242 to 420: score 85.3, E = 1.2e-21 *->DivFllDgSgSigeenlFekvkdFvkklveknldigpdgtrVglvqY D+v+++D+SgS+++ ++++k+ v ++++ + d++ V++ + mKIAA0558 242 DMVIIVDVSGSVSGLT-LKLMKTSVCEMLD----TLSDDDYVNVASF 283 ssdvrtefsLndysskddllaav...lknlrylgGgTnNtgkALkyalen + ++++ ++ + ++++v +++ + +G+T ++++ya ++ mKIAA0558 284 NEKAQPVSCFTHLVQANVRNKKVfkeAVQGMVAKGTTG-YKAGFEYAFDQ 332 lfsstMikrnrsagsRpenapkvlillTDGksndggdve.aaaalrdkkk l+ s + R n +k+++++TDG + +dv ++ + + mKIAA0558 333 LQNS--------NITRA-NCNKMIMMFTDGGEDRVQDVFeKYNWPNRT-- 371 gvgitvfavGvGgdvdeaeLr.iasepeseghvfyvedfdalwlelqdiq v++++f+vG+ +++d L+ +a +++ g++f +++ a+ ++ q++ mKIAA0558 372 -VRVFTFSVGQ-HNYDVTPLQwMA--CTNKGYYFEIPSIGAIRINTQEYL 417 eql<-* + l mKIAA0558 418 DVL 420 Cache_1: domain 1 of 1, from 436 to 525: score 133.4, E = 4.1e-36 *->wTePYvdaastgdmViTvsvPvydrtneqrnktn.dngdllGVvgiD wT++Y+da ++++V+T ++Pv+++t+ +++++++n+ +lGV+giD mKIAA0558 436 WTNVYEDAL-GLGLVVTGTLPVFNLTQ--DGPGEkKNQLILGVMGID 479 vpledLlkltksiklGktGYaFivdnnGkvlaHPnlrpvtkllkdw<-* v l d+++lt++++lG +GY+F++d nG+vl+HPnl+p t++ ++ mKIAA0558 480 VALNDIKRLTPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREP 525 //