hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpf/mpf00666/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0543 ( 937 res) mpf00666 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- KRAB krueppel associated box 106.6 2.8e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- KRAB 1/1 238 298 .. 1 62 [] 106.6 2.8e-27 Alignments of top-scoring domains: KRAB: domain 1 of 1, from 238 to 298: score 106.6, E = 2.8e-27 *->VtFeDVAVdFsqEEWeqLDpaQrnLYRdVMlENYsnLvSLGgfqvsk tFeD AV+Fs+EEW +LD Q++LYRd M+ Y+ L+SL+ ++ +k mKIAA0543 238 ATFEDLAVYFSREEWSLLDKQQKELYRDGMQMSYELLASLE-PPAAK 283 pdliskLEqgeEpwi<-* pdli+kLEq+ pwi mKIAA0543 284 PDLITKLEQRAAPWI 298 //