hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpf/mpf00666/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0543 ( 937 res) mpf00666 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- KRAB KRAB box 73.0 6.2e-18 1 hATC hAT family dimerisation domain 2.9 0.1 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- KRAB 1/1 238 278 .. 1 41 [] 73.0 6.2e-18 hATC 1/1 786 869 .. 1 94 [] 2.9 0.1 Alignments of top-scoring domains: KRAB: domain 1 of 1, from 238 to 278: score 73.0, E = 6.2e-18 *->VtFeDVAVdFtqEEWglLdpaQrnLYrdVMlENyrnLvSlg<-* tFeD AV+F++EEW lLd Q++LYrd M+ y+ L+Sl+ mKIAA0543 238 ATFEDLAVYFSREEWSLLDKQQKELYRDGMQMSYELLASLE 278 hATC: domain 1 of 1, from 786 to 869: score 2.9, E = 0.1 *->ELdkYlselpvlprnteprgledfdvLeWWkeaqnssryPiLsklAr L ++ s + +n f L+ + + r+P+L ++ mKIAA0543 786 LLKEWQSL-KAATQNL------LFSMLCKCA-LTQHCRFPLLRRFVV 824 diLsiPvssaasErsFStgklgrvldesrnrlepenveaLlcledwl<-* + s+P+s+ + r F ++ ++ +e r++l e ++ L+ + + mKIAA0543 825 VVVSVPISTSCCARGFKAM--SKIRTEERTKLSNEVLDTLMMTAVNG 869 //