hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj13077/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0517 ( 787 res) mfj13077 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- NHL NHL repeat 216.7 3.5e-61 6 zf-B_box B-box zinc finger 55.2 1.4e-12 1 Filamin Filamin/ABP280 repeat 54.8 1.8e-12 1 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 39.9 5.6e-08 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- zf-C3HC4 1/1 66 106 .. 1 50 [] 39.9 5.6e-08 zf-B_box 1/1 158 197 .. 1 46 [] 55.2 1.4e-12 Filamin 1/1 365 461 .. 1 101 [] 54.8 1.8e-12 NHL 1/6 529 556 .. 1 29 [] 34.0 3.3e-06 NHL 2/6 576 603 .. 1 29 [] 37.9 2.3e-07 NHL 3/6 618 645 .. 1 29 [] 29.3 8.9e-05 NHL 4/6 665 692 .. 1 29 [] 39.3 8.7e-08 NHL 5/6 712 739 .. 1 29 [] 49.6 7e-11 NHL 6/6 756 783 .. 1 29 [] 41.5 1.8e-08 Alignments of top-scoring domains: zf-C3HC4: domain 1 of 1, from 66 to 106: score 39.9, E = 5.6e-08 *->CrICleelkepsndfplilpCgHsGslkyfCrsClerwlss.sgntt C ICle +k+p+ +lpC+H+ fC+ Cl++++ +s + + mKIAA0517 66 CSICLERYKNPK-----VLPCLHT-----FCERCLQNYIPAhSLTLS 102 CplC<-* Cp+C mKIAA0517 103 CPVC 106 zf-B_box: domain 1 of 1, from 158 to 197: score 55.2, E = 1.4e-12 *->ervCpeHg.ekaslfCedDqalLCvvCdesgeHsanklargHtvvpl + Cp+H++ +++++C+ +++++C++C+e eH + H +vpl mKIAA0517 158 PLSCPNHDgNVMEFYCQSCETAMCRECTEG-EH------AEHPTVPL 197 <-* mKIAA0517 - - Filamin: domain 1 of 1, from 365 to 461: score 54.8, E = 1.8e-12 *->agDasKVkAyGPGLeggGVkvgkPaeFtVdtVdkdGepkgAGgGgLs ++ as A G GL + g+P + t+ t dkdGe+++ G++ L+ mKIAA0517 365 NAVASETVATGEGLRQT--IIGQPMSVTITTKDKDGELCKTGNAYLT 409 VkVeGPsGaeAvvevkvtDngDGtYtVsYtPtepGdYtvnVtygGehIPg + + P+G v + ++ Dn++GtY Yt +++Gd t + + ++hI g mKIAA0517 410 AELSTPDGS--VADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRG 457 SPFk<-* SPFk mKIAA0517 458 SPFK 461 NHL: domain 1 of 6, from 529 to 556: score 34.0, E = 3.3e-06 *->lnrPhGvavdpsdGrvyVaDsenhrvqvf<-* + + +Gva + ++G +++aDs+n +vq+f mKIAA0517 529 FTNLQGVAAS-TSGKILIADSNNQCVQIF 556 NHL: domain 2 of 6, from 576 to 603: score 37.9, E = 2.3e-07 *->lnrPhGvavdpsdGrvyVaDsenhrvqvf<-* l+rP+Gvav ++G++++aD++n v +f mKIAA0517 576 LQRPTGVAVH-PSGDIIIADYDNKWVSIF 603 NHL: domain 3 of 6, from 618 to 645: score 29.3, E = 8.9e-05 *->lnrPhGvavdpsdGrvyVaDsenhrvqvf<-* l P Gv vd ++G+++V+D+ +v++f mKIAA0517 618 LMGPKGVSVD-RNGHIIVVDNKACCVFIF 645 NHL: domain 4 of 6, from 665 to 692: score 39.3, E = 8.7e-08 *->lnrPhGvavdpsdGrvyVaDsenhrvqvf<-* + Ph av+ s+++++++D++nh v+vf mKIAA0517 665 FAGPHFAAVN-SNNEIIITDFHNHSVKVF 692 NHL: domain 5 of 6, from 712 to 739: score 49.6, E = 7e-11 *->lnrPhGvavdpsdGrvyVaDsenhrvqvf<-* +n P+Gvavd s+G+++VaD +n+r+qvf mKIAA0517 712 FNAPTGVAVD-SNGNIIVADWGNSRIQVF 739 NHL: domain 6 of 6, from 756 to 783: score 41.5, E = 1.8e-08 *->lnrPhGvavdpsdGrvyVaDsenhrvqvf<-* l+ P+G+a++ sdG+v+VaDs+nh+ +v+ mKIAA0517 756 LYGPQGLALT-SDGHVVVADSGNHCFKVY 783 //