hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mfj/mfj10183/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0482 ( 1331 res) mfj10183 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAS PAS domain 42.3 6.3e-08 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PAS 1/2 248 315 .. 1 68 [] 12.2 7.6 PAS 2/2 388 454 .. 1 68 [] 30.1 0.00031 Alignments of top-scoring domains: PAS: domain 1 of 2, from 248 to 315: score 12.2, E = 7.6 *->erlraileslpdgiivld.ldGrilyaNpaaeellGyspeeliGksl + l + +++ ++++ l+Gri+y+++ a ll ++ G + mKIAA0482 248 ITSEYTLRNQDTFSVAVSfLTGRIVYISEQAGVLLRCKRDVFRGARF 294 lelihpedrlleevqe.lqrlla<-* +el+ p+d + + +++ mKIAA0482 295 SELLAPQDV--GVFYGsTTPSRL 315 PAS: domain 2 of 2, from 388 to 454: score 30.1, E = 0.00031 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll + +i + ++++ + +++++a+ llGy p++l+G ++l mKIAA0482 388 YEAPRIPPDKRIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVL 434 elihpedrlleevqe.lqrlla<-* ++hpedr + +++ +++ l+ mKIAA0482 435 LFLHPEDR--PLMLAiHKKILQ 454 //