hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/TIGRFAMs_HMM.LIB
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg03637/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0476  ( 851 res)   mbg03637

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PPR      PPR: pentatricopeptide repeat domain            27.9    0.00024   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PPR        1/1     169   203 ..     1    35 []    27.9  0.00024

Alignments of top-scoring domains:
PPR: domain 1 of 1, from 169 to 203: score 27.9, E = 0.00024
                   *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-*
                      v+Y +l+  +++ g++   ++++ eM+++Gi+P++   
   mKIAA0476   169    VCYRVLMQLCSHYGQPVLSVRVMLEMRRAGIVPNT    203  

//