hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg03637/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0476 ( 851 res) mbg03637 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PPR PPR repeat 25.0 0.0018 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PPR 1/1 169 203 .. 1 35 [] 25.0 0.0018 Alignments of top-scoring domains: PPR: domain 1 of 1, from 169 to 203: score 25.0, E = 0.0018 *->vtYntlIsgycknGkleeAlelfeeMkekGikPdv<-* v+Y +l++ +++ G++ ++++ eM++ Gi+P++ mKIAA0476 169 VCYRVLMQLCSHYGQPVLSVRVMLEMRRAGIVPNT 203 //