hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg01969/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0453  ( 1918 res)   mbg01969

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
UBA      Ubiquitin associated domain                     31.7     0.0001   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
UBA        1/1     167   204 ..     1    38 []    31.7   0.0001

Alignments of top-scoring domains:
UBA: domain 1 of 1, from 167 to 204: score 31.7, E = 0.0001
                   *->deekieqLleMGFsreeavdALratngNverAaeyLls<-*
                      +e ++++L e+GFs + +++AL  ++g++  Aa +L+    
   mKIAA0453   167    LELQLARLQELGFSMDDCRKALLVCQGQLKKAASWLFK    204  

//