hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj02793/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0436 ( 484 res) mpj02793 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Peptidase_S9 Prolyl oligopeptidase family 94.5 2.1e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Peptidase_S9 1/1 245 470 .. 1 229 [] 94.5 2.1e-24 Alignments of top-scoring domains: Peptidase_S9: domain 1 of 1, from 245 to 470: score 94.5, E = 2.1e-24 *->psfsvwnlqlladrGyvvavaniRGsggyGrawhdagkrdlgqnefd +f+ + +l+d G + a++++RG+g+ G +wh +g++ ++ n + mKIAA0436 245 MNFR-PEKRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLA 290 DfiaaaeyLieqgpyvDpdrlaiwGgSyGGyltgaalnkqrpdlFkaava D++a+++ L +qg + p+ S+GG l+ga n +p+l +a+ mKIAA0436 291 DLVACIKTLHSQG-FSQPSLTTLSAFSAGGVLVGALCN-SKPELLRAVTL 338 vvpvvDwltymsdtslpysfteaeymewgnpwdeneegYrylspyspydn ++p++D+l++m+dt+lp +t e +ewgnp +e++ y++ y p +n mKIAA0436 339 EAPFLDVLNTMLDTTLP--LTLEELEEWGNPSS-DEKHKNYIKRYCPCQN 385 vkaqaypplLlihGlhDdRVpyqealklvaaLq...........alktGk +k+q yp++ ++ ++D RVp+ + +L++ +++++ ++ ++ mKIAA0436 386 IKPQHYPSVHITAYENDERVPLKGIVNYTEKLKeavaehtkgagEGYQPP 435 npflllifpdeGHdLSgggkprnkrlkeyarllaFllkvlggt<-* n + l i p+ +H + +++ k + +++ Fl + lg++ mKIAA0436 436 N-IILDIQPGGNH----VI--EDSH-KKITTQMKFLYEELGLD 470 //