hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg06889/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0421  ( 683 res)   mbg06889

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
FATC     FATC domain                                     46.4    6.2e-10   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
FATC       1/1     651   683 .]     1    33 []    46.4  6.2e-10

Alignments of top-scoring domains:
FATC: domain 1 of 1, from 651 to 683: score 46.4, E = 6.2e-10
                   *->epLsvegqvedLIqqATspenLsqmYiGWcPfl<-*
                        +sv +qv++ I++AT+ +nL+q+Y+GW++++   
   mKIAA0421   651    RRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV    683  

//