hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mfj/mfj04247/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0400 ( 970 res) mfj04247 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ArfGap Putative GTP-ase activating proteins for the 104.0 1.7e-26 1 PH Pleckstrin homology domain. 76.7 2.9e-18 1 SH3 Src homology 3 domains 68.7 7.2e-16 1 ANK ankyrin repeats 52.4 5.9e-11 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PH 1/1 321 414 .. 1 82 [] 76.7 2.9e-18 ArfGap 1/1 436 556 .. 1 139 [] 104.0 1.7e-26 ANK 1/3 599 631 .. 1 30 [] 18.3 1.1 ANK 2/3 635 664 .. 1 30 [] 32.2 6.9e-05 ANK 3/3 668 698 .. 1 30 [] 1.9 2.6e+03 SH3 1/1 911 969 .. 1 58 [] 68.7 7.2e-16 Alignments of top-scoring domains: PH: domain 1 of 1, from 321 to 414: score 76.7, E = 2.9e-18 *->vikeGwLlkks...k.swkkryfvLfngvLlyyksk..kpkgsipLs +++ G L+kks++ ++ w+kr + ++ng+L++ + ++p +++L mKIAA0400 321 TERNGNLYKKSdgiRkVWQKRKCSVKNGFLTISHGTanRPPAKLNLL 367 gcsvre.p....cFeivt.drtlllqAeseeereeWvealqsaiaka<-* +c+v+ +p++++cF ++++drt+++qAe+e+e++ W++ lq+ ++a mKIAA0400 368 TCQVKTnPeekkCFDLIShDRTYHFQAEDEQECQIWMSVLQNSKEEA 414 ArfGap: domain 1 of 1, from 436 to 556: score 104.0, E = 1.7e-26 *->eealqlLRsikpgNkkCfDCGavpnPtWaSvnlGvflCieCSGiHRs +e + ++++++ gN +C+DCGa p+PtW S nlG++ CieCSGiHR mKIAA0400 436 KEIISEVQRMT-GNDVCCDCGA-PDPTWLSTNLGILTCIECSGIHRE 480 LfGvHiSkVnvRSltLDtWteeeLrllesckgGNenansfwesnlddfsl L GvH S+ SltLD eL l + ++GN ++n++ e l+ ++ mKIAA0400 481 L-GVHYSRM--QSLTLDVLGTSELLLAK--NIGNAGFNEIMECCLPSEDP 525 kpkdsdaaasvKCeddrqkyesfiaaKYeeklfrvdkesaee<-* +++++ +d ++ +i aKY e++ ++++ + mKIAA0400 526 VKPNPG--------SDMIARKDYITAKYMERRY---ARKKHA 556 ANK: domain 1 of 3, from 599 to 631: score 18.3, E = 1.1 *->dGrTpLHlAaen...gnlevvklLldkgadina<-* + T+LHlA+++ ++ +l++v +L+++++++++ mKIAA0400 599 PDETALHLAVRSvdrTSLHIVDFLVQNSGNLDK 631 ANK: domain 2 of 3, from 635 to 664: score 32.2, E = 6.9e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* G T+LH+++ ++n e++klLl+ +a+i++ mKIAA0400 635 KGSTALHYCCLTDNAECLKLLLRGKASIEI 664 ANK: domain 3 of 3, from 668 to 698: score 1.9, E = 2.6e+03 *->dGrTpLHlAaengnlevvklLldkga.dina<-* G TpL +A + +++++ +lL ++ + +n mKIAA0400 668 SGETPLDIAKRLKHEHCEELLTQALSgRFNS 698 SH3: domain 1 of 1, from 911 to 969: score 68.7, E = 7.2e-16 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnr.tGke ++v+AlY++ a+n+dEL+F++GD+i+v ++d++Ww G ++++ ++ mKIAA0400 911 KRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGePSRK 957 GlfPsnYVeeie<-* G fP ++V i mKIAA0400 958 GAFPVSFVHFIA 969 //