hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mbg/mbg08208/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0395  ( 198 res)   mbg08208

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
HOX      Homeodomain                                     40.6    2.1e-07   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
HOX        1/1       6    68 ..     1    63 []    40.6  2.1e-07

Alignments of top-scoring domains:
HOX: domain 1 of 1, from 6 to 68: score 40.6, E = 2.1e-07
                   *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv
                      + +  +  t +Q++ L++ F ++++Ps ++ + + +++gL++  V  
   mKIAA0395     6    PSKVSYKKTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVR 52   

                   WFQNRRakwkrqekkk<-*
                   WF   R+ +k+ + k+   
   mKIAA0395    53 WFGDSRYALKNGQLKW    68   

//