hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg00223/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0375 ( 1538 res) mbg00223 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SH3 Src homology 3 domains 52.3 6.5e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SH3 1/1 1472 1527 .. 1 58 [] 52.3 6.5e-11 Alignments of top-scoring domains: SH3: domain 1 of 1, from 1472 to 1527: score 52.3, E = 6.5e-11 *->eyvvAlYDyeaqnedELsFkkGDiitvleksddgWweGelnrtGkeG ++v+Al+ + a++++ LsF+kGDi++vl ++W+++ ++ +G mKIAA0375 1472 CEVQALCHHLATGPGQLSFHKGDILRVLGPARGDWLRCSRG--PDTG 1516 lfPsnYVeeie<-* l+P YV++ + mKIAA0375 1517 LVPLAYVTLPP 1527 //