hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg06119/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0347 ( 1267 res) mbg06119 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAS PAS domain 26.7 0.0031 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PAS 1/2 189 256 .. 1 68 [] 5.6 58 PAS 2/2 329 395 .. 1 68 [] 21.2 0.15 Alignments of top-scoring domains: PAS: domain 1 of 2, from 189 to 256: score 5.6, E = 58 *->erlraileslpdgiivld.ldGrilyaNpaaeellGyspeeliGksl + i+ +++++ ++++ G+ily++ ++ ++ ++ + + mKIAA0347 189 ITSEYIVKNADMFAVAVSlVSGKILYISNQVASIFHCKKDAFSDAKF 235 lelihpedrlleevqe.lqrlla<-* e++ p d + + mKIAA0347 236 VEFLAPHDV--SVFHSyTTPYKL 256 PAS: domain 2 of 2, from 329 to 395: score 21.2, E = 0.15 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll + +i + ++++ + ++++a llGy p++li++++l mKIAA0347 329 YEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVL 375 elihpedrlleevqe.lqrlla<-* +hp dr + +++ +++ l+ mKIAA0347 376 VQLHPSDR--PLMLAiHKKILQ 395 //