hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj01034/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0346 ( 708 res) mpj01034 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- JmjC JmjC domain 164.1 2.3e-45 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- JmjC 1/1 442 550 .. 1 126 [] 164.1 2.3e-45 Alignments of top-scoring domains: JmjC: domain 1 of 1, from 442 to 550: score 164.1, E = 2.3e-45 *->wlyiGmpfSttpwHiedqglySinylhfgapkvWYaiPpeyaekfek +ly+++p+S+tp+H+e+++++S+n+++++++++W+a+ ++y+e++ mKIAA0346 442 QLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETIS- 487 lhkflskhfsapdleggeqpdhDlrhlvtlisPkvlpLlenGipvyrfvQ +f++ h+ + +l+ +++P++++L++ +ipvyrfvQ mKIAA0346 488 --AFCDRHG--------------VDYLTGSWWPILDDLYASNIPVYRFVQ 521 kpGEfVftfPgayHqvfNlGfniaeavNF<-* +pG+ V++++g++H+v+ +G+++++a+N+ mKIAA0346 522 RPGDLVWINAGTVHWVQATGWCNNIAWNV 550 //