hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg08118/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0338 ( 907 res) mbg08118 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- B41 Band 4.1 homologues 274.1 1.1e-77 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- B41 1/1 121 316 .. 1 232 [] 274.1 1.1e-77 Alignments of top-scoring domains: B41: domain 1 of 1, from 121 to 316: score 274.1, E = 1.1e-77 *->spkprvlkVylldgttlefevdssttaeelletvcrklglspresey + k ++V+lld + +e+ev+++ ++++l++ vc++l+l +e++y mKIAA0338 121 KFKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNL--LEKDY 165 FgLqfedkdedshWldpaktilkqdvkspksepltlyFRvkFyppdwhgp FgL f+d d+++ Wldp+k+i+kq+++ p+++ F vkFyppd mKIAA0338 166 FGLTFCDADSQKNWLDPSKEIKKQIRS----SPWNFAFTVKFYPPD---- 207 peqlkeDptrynllylQvrddilsGrlpcpseeeallLAaLalqaefGdy p ql+eD+try +l+lQ+r di++Grlpc+ + +++lL+++a+qae+Gdy mKIAA0338 208 PAQLTEDITRY-YLCLQLRADIITGRLPCS-FVTHALLGSYAVQAELGDY 255 dpeeeekkkslkhvakelslkrflPkqlldsikasflqiqltlkewrerI d e +hv +++s+ rf P+q + e++erI mKIAA0338 256 DAE--------EHVGNYVSELRFAPNQ---------------TRELEERI 282 velhkehaglspeeaklkYLelarrLpptYGvelF<-* +elhk ++g++p ea++++Le+a++L +YGv+l+ mKIAA0338 283 MELHKTYRGMTPGEAEIHFLENAKKLS-MYGVDLH 316 //