hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbf/mbf01556/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0334 ( 857 res) mbf01556 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAS PAS domain 64.4 1.4e-14 2 HLH helix loop helix domain 54.2 1.7e-11 1 PAC Motif C-terminal to PAS motifs (likely to co 37.3 2.1e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HLH 1/1 42 92 .. 1 61 [] 54.2 1.7e-11 PAS 1/2 111 177 .. 1 68 [] 36.0 5.1e-06 PAS 2/2 266 332 .. 1 68 [] 28.5 0.00094 PAC 1/1 338 381 .. 1 43 [] 37.3 2.1e-06 Alignments of top-scoring domains: HLH: domain 1 of 1, from 42 to 92: score 54.2, E = 1.7e-11 *->narERrlrRRekiNeqafdeLrslvPtlpkgggnskKlsKasiLrlA n +E+ +RR++ N ++eL s++P gn +K++K ++L++ mKIAA0334 42 NKSEK--KRRDQFNV-LIKELGSMLP------GNARKMDKSTVLQKS 79 ieYIrksLqeqlqe<-* i+++ ++ +e ++ mKIAA0334 80 IDFL-RKHKETTAQ 92 PAS: domain 1 of 2, from 111 to 177: score 36.0, E = 5.1e-06 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll e+ + +le+l+ +++++ dG i+y++++++ ll p +l+++s++ mKIAA0334 111 EFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIF 157 elihpedrlleevqe.lqrlla<-* ++i+++++ ev l ++l mKIAA0334 158 NFIPEGEH--SEVYKiLSTHLL 177 PAS: domain 2 of 2, from 266 to 332: score 28.5, E = 0.00094 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll ++ ++ e ++ +++l++++l+ +++a + Gy p e++G+s + mKIAA0334 266 KEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGY 312 elihpedrlleevqe.lqrlla<-* +++h +d+ e + +++l++ mKIAA0334 313 DYYHVDDL--ENLAKcHEHLMQ 332 PAC: domain 1 of 1, from 338 to 381: score 37.3, E = 2.1e-06 *->tveyrlrrkdGsliwvlvsaspird.edgevegilgvvrDITer<-* ++ yr+++k++++iw++++ ++ +++++ ++e+i++++++++ + mKIAA0334 338 SCYYRFLTKGQQWIWLQTHYYITYHqWNSRPEFIVCTHTVVSYA 381 //