hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mbh/mbh00930/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0332  ( 712 res)   mbh00930

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
Surp     Surp module                                     57.3    3.3e-13   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
Surp       1/1     114   159 ..     1    47 []    57.3  3.3e-13

Alignments of top-scoring domains:
Surp: domain 1 of 1, from 114 to 159: score 57.3, E = 3.3e-13
                   *->IkltAqfVakgGlefeakllerernndprFdFLnpsndpyhkYYrkk
                      I    +fV++ G+ fea+++ re nn p+F FL+++  p h YYr+k
   mKIAA0332   114    IHRMIEFVVREGPMFEAMIMNREINN-PMFRFLFENQTPAHVYYRWK 159  

                   <-*
                      
   mKIAA0332     -     -    

//