hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj34062/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0327 ( 933 res) mfj34062 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Cadherin Cadherin domain 277.2 2.2e-79 6 Cadherin_2 Cadherin-like 186.1 5.7e-52 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Cadherin 1/6 32 110 .. 1 107 [] 8.1 0.22 Cadherin_2 1/1 30 113 .. 1 84 [] 186.1 5.7e-52 Cadherin 2/6 139 234 .. 1 107 [] 48.1 2e-10 Cadherin 3/6 248 339 .. 1 107 [] 76.4 6e-19 Cadherin 4/6 353 444 .. 1 107 [] 33.9 3.6e-06 Cadherin 5/6 458 554 .. 1 107 [] 67.0 4.1e-16 Cadherin 6/6 576 666 .. 1 107 [] 49.4 7.7e-11 Alignments of top-scoring domains: Cadherin: domain 1 of 6, from 32 to 110: score 8.1, E = 0.22 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr svpE + Gt v+++ +P+ + +r + ++g ++ F+ mKIAA0327 32 IRYSVPEETDKGTVVGNISKDLGLEPRELAERGVRIVSRGR-SQLFS 77 IdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgggppls ++p+ G+ + t+ ++DREe + ++s mKIAA0327 78 LNPRGGS----LVTAGRIDREEL-------------C----------AQS 100 statvtitVl<-* +++ v+i++l mKIAA0327 101 TPCLVNINIL 110 Cadherin_2: domain 1 of 1, from 30 to 113: score 186.1, E = 5.7e-52 *->gqirYSVpEEterGsfVGNlAKDLGLdvqeLaaRgaRivSggnkqyF gqirYSVpEEt++G++VGN+ KDLGL+++eLa+Rg+RivS+g+ q+F mKIAA0327 30 GQIRYSVPEETDKGTVVGNISKDLGLEPRELAERGVRIVSRGRSQLF 76 qlnletGdLlvnERiDREeLCgqsepCvLhlevllEn<-* +ln++ G+L++++RiDREeLC+qs+pC+++ ++l+E mKIAA0327 77 SLNPRGGSLVTAGRIDREELCAQSTPCLVNINILVEE 113 Cadherin: domain 2 of 6, from 139 to 234: score 48.1, E = 2e-10 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr ++ + E a++G + A+D+D g N+ +Y ++++ +F+ mKIAA0327 139 LEVKINEIAAPGARYPLPEAVDPD--VGINSLQSYQLSPNR---HFS 180 IdpdtGdnegi...isttkpLDREeifngeYeLtveAtDadpllasgggp ++ +tGd+ i++++ + + LDREe ++++L++ A+D+ g+p mKIAA0327 181 LHLQTGDDGTInpeLVLERTLDREEE--PTHHLVLTASDG-------GEP 221 plsstatvtitVl<-* +ssta + itVl mKIAA0327 222 RRSSTALIQITVL 234 Cadherin: domain 3 of 6, from 248 to 339: score 76.4, E = 6e-19 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnp..ggw y + v En+++Gt +ltv+A+D+D +g Ng+++Y++ + n++++ mKIAA0327 248 YRVKVLENVAPGTLLLTVRASDPD--EGVNGKVTYKFRKINEkqSLL 292 FrIdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgggpp F+++++tG+ +++k+LD+Ee+ + Ye + A D + + mKIAA0327 293 FHLHENTGE----MTVAKNLDYEEC--SLYEMEIQAEDVG---------A 327 lsstatvtitVl<-* l ++ v+i V+ mKIAA0327 328 LLGRSKVIIMVE 339 Cadherin: domain 4 of 6, from 353 to 444: score 33.9, E = 3.6e-06 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr v En+ +Gt ++ ++++D D +g Ng+++ ++ + F+ mKIAA0327 353 LFNPVLENSLPGTVIAFLNVHDQD--SGKNGQVVCY--THD-NLPFK 394 IdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgggppls +++ + dn + t k LDRE+ ++Y++tv+A+D g ppls mKIAA0327 395 LEK-SIDNYYRLVTWKYLDREKV--STYNITVIASDL-------GAPPLS 434 statvtitVl<-* +++++ tV mKIAA0327 435 TETYIALTVA 444 Cadherin: domain 5 of 6, from 458 to 554: score 67.0, E = 4.1e-16 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnp..... y+a +pEn +G ++ ++tA+D+D + N++++Ys +++ ++ + mKIAA0327 458 YTAYLPENNLRGASIFSLTAHDPD--SQENAQVTYSVSEDTIqgvpl 502 ggwFrIdpdtGdnegiisttkpLDREeifngeYeLtveAtDadpllasgg + +I++dtG ++ ++ D E+i + L v+AtD+ g mKIAA0327 503 SSYISINSDTGI----LYALQSFDFEKI--QDLQLLVIATDS-------G 539 gpplsstatvtitVl<-* +pplss +++ Vl mKIAA0327 540 SPPLSSNVSLSLFVL 554 Cadherin: domain 6 of 6, from 576 to 666: score 49.4, E = 7.7e-11 *->ysasvpEnapvGtevltvtAtDaDdPlgpNgrirYsilggnpggwFr + + +p G v+ v A+D+D +g+N+ ++Y++l+ +++g F+ mKIAA0327 576 VELAPRSAEP-GYLVTKVVAVDKD--SGQNAWLSYRLLKASEPGLFS 619 IdpdtGdnegiisttkp.LDREeifngeYeLtveAtDadpllasgggppl + +tG+ ++t++ LDR + + +L++ ++D+ g+ppl mKIAA0327 620 VGLHTGE----VRTARAlLDRDAL--KQ-NLVMAVQDH-------GQPPL 655 sstatvtitVl<-* s+t+t+t+ V mKIAA0327 656 SATVTLTVAVA 666 //