hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/TIGRFAMs_HMM.LIB Sequence file: /cdna4/rodent/full/goal/mbg/mbg05988/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0307 ( 725 res) mbg05988 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- sensory_box sensory_box: PAS domain S-box 21.0 0.029 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- sensory_box 1/1 334 461 .. 1 130 [] 21.0 0.029 Alignments of top-scoring domains: sensory_box: domain 1 of 1, from 334 to 461: score 21.0, E = 0.029 *->reseeryraifesspdaiivvdleGnilyvnpafeelfGysaeellG + + + + + ++++G+i++v p+ + Gy +++llG mKIAA0307 334 SSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLG 380 rnvlelipeedreelrerierlletgerepvseerrvlgrrkdGseiwve + +le+ ++ed +lre ++++ + ++++ s +r+ r+k+ +++ ++ mKIAA0307 381 KDILEFCHPEDQSHLRESFQQVVK-LKGQVLSVMYRF--RTKNREWLLIR 427 vsvspird.snggvlgvlgivrDiterkeaeeal<-* s ++ + ++ +v+++ ++ ++++ + +l mKIAA0307 428 TSSFTFQNpYSDEIEYVICTNTNVKQLQQQQAEL 461 //