hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbg/mbg05988/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0307 ( 725 res) mbg05988 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAS PAS domain 84.7 1.1e-20 2 HLH helix loop helix domain 63.3 3.1e-14 1 PAC Motif C-terminal to PAS motifs (likely to co 30.6 0.00022 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HLH 1/1 82 135 .. 1 61 [] 63.3 3.1e-14 PAS 1/2 150 217 .. 1 68 [] 43.2 3.4e-08 PAS 2/2 338 404 .. 1 68 [] 41.5 1.1e-07 PAC 1/1 411 454 .. 1 43 [] 30.6 0.00022 Alignments of top-scoring domains: HLH: domain 1 of 1, from 82 to 135: score 63.3, E = 3.1e-14 *->narERrlrRRekiNeqafdeLrslvPtlpkgggnskKlsKasiLrlA +++ER rRR+k+ + ++ eL+++vPt+ + +K++K++iLr+A mKIAA0307 82 SEIER--RRRNKMTQ-YITELSDMVPTCS---ALARKPDKLTILRMA 122 ieYIrksLqeqlqe<-* ++++ ks++ + mKIAA0307 123 VSHM-KSMRGTGNK 135 PAS: domain 1 of 2, from 150 to 217: score 43.2, E = 3.4e-08 *->erlraileslpdgiivld.ldGrilyaNpaaeellGyspeeliGksl e + ile+++ +++v+ ++Gr++y++++++ l++++ e+ G +l mKIAA0307 150 ELKHLILEAADGFLFVVAaETGRVIYVSDSVTPVLNQPQSEWFGSTL 196 lelihpedrlleevqe.lqrlla<-* +e +hp+d e ++e+l ++ + mKIAA0307 197 YEQVHPDDV--EKLREqLCTSEN 217 PAS: domain 2 of 2, from 338 to 404: score 41.5, E = 1.1e-07 *->erlraileslpdgiivldldGrilyaNpaaeellGyspeeliGksll + + + +++ +++ dG i++++p++ Gy p++l+Gk++l mKIAA0307 338 CMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDIL 384 elihpedrlleevqe.lqrlla<-* e++hped+ +++e++q++++ mKIAA0307 385 EFCHPEDQ--SHLREsFQQVVK 404 PAC: domain 1 of 1, from 411 to 454: score 30.6, E = 0.00022 *->tveyrlrrkdGsliwvlvsaspird.edgevegilgvvrDITer<-* +v yr+r+k+ ++ +++s + ++ ++e+e+++++++++ + mKIAA0307 411 SVMYRFRTKNREWLLIRTSSFTFQNpYSDEIEYVICTNTNVKQL 454 //