hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg05988/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0307 ( 725 res) mbg05988 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAS PAS fold 72.4 9.2e-18 2 HLH Helix-loop-helix DNA-binding domain 63.9 3.5e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HLH 1/1 77 130 .. 1 53 [] 63.9 3.5e-15 PAS 1/2 150 257 .. 1 123 [] 67.7 2.4e-16 PAS 2/2 338 451 .. 1 123 [] 4.7 0.92 Alignments of top-scoring domains: HLH: domain 1 of 1, from 77 to 130: score 63.9, E = 3.5e-15 *->rRrahnarERrRRdriNdafeeLrellPtla..pskKlsKaeiLrlA R++h+++ERrRR+++ + + eL +++Pt ++ +K +K++iLr+A mKIAA0307 77 SRENHSEIERRRRNKMTQYITELSDMVPT-CsaLARKPDKLTILRMA 122 veYIksLq<-* v+++ks++ mKIAA0307 123 VSHMKSMR 130 PAS: domain 1 of 2, from 150 to 257: score 67.7, E = 2.4e-16 *->edlrailesnlpdgifvvDvedGrilyvNaaaeellGlsreeviGks e+ + ile+ ++ + fvv e Gr+ yv+++ + l+++++e+ G + mKIAA0307 150 ELKHLILEA-ADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGST 195 lldlipeeddaeclvaelllqaleqgee.rgvevsfrvsgqrflvrdgrp l+++++++ ++e+l+++l + e++ ++++ + g++ mKIAA0307 196 LYEQVHPD------DVEKLREQLCTSENsMTGRILDLK--------TGTV 231 ihvevraspvrdaggeilgflgvlrDi<-* + ++ s+++++g+++ f++++r+ mKIAA0307 232 KKEGQQSSMRMCMGSRR-SFICRMRCG 257 PAS: domain 2 of 2, from 338 to 451: score 4.7, E = 0.92 *->edlrailesnlpdgifvvDvedGrilyvNaaaeellGlsreeviGks + + + +++ + dG+i++v + ++ G+++++++Gk mKIAA0307 338 CMDMSGMSV-PTEFLSRHN-SDGIITFVDPRCISVIGYQPQDLLGKD 382 lldlipeeddaeclvaelllqaleqgee.rgvevsfrvsgqrflvrdgrp +l++ ++ed++ ++e ++q+ + +++ +v +fr+ ++r+ mKIAA0307 383 ILEFCHPEDQSH--LRESFQQVVKLKGQvLSVMYRFRT--------KNRE 422 ihvevraspvrd...aggeilgflgvlrDi<-* ++++r+s ++++++ ++ei +++++ + mKIAA0307 423 -WLLIRTSSFTFqnpYSDEIEYVICTNTNV 451 //