hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg08362/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0298 ( 208 res) mbg08362 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Bromodomain Bromodomain 84.1 2.8e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Bromodomain 1/1 35 127 .. 1 92 [] 84.1 2.8e-21 Alignments of top-scoring domains: Bromodomain: domain 1 of 1, from 35 to 127: score 84.1, E = 2.8e-21 *->lnklllkvlealdehgpralpflfpVlpsklelPDYYeiIkkPMDLk + ++k+ + +++ +++l+ +f + p+ + YY+iIk+PMDL+ mKIAA0298 35 SMYDQKKCEKLVLSLCCNSLSLPFHE-PVSPLARHYYQIIKRPMDLS 80 TIkkklkngk...YissleeFvaDfnLmfsNAktYNepdsevykdAkk<- I++kl++ + +Y +++ee v D++Lmf+N+ ++N pdsev ++++ mKIAA0298 81 IIRRKLQKKDpahY-TTPEEVVSDVRLMFWNCAKFNYPDSEVAEAGRC 127 * mKIAA0298 - - //