hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mia/mia06063/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0271 ( 192 res) mia06063 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Bcl-2 Apoptosis regulator proteins, Bcl-2 family 192.5 6.7e-54 1 BH4 Bcl-2 homology region 4 53.8 3.7e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- BH4 1/1 7 33 .. 1 27 [] 53.8 3.7e-12 Bcl-2 1/1 47 145 .. 1 107 [] 192.5 6.7e-54 Alignments of top-scoring domains: BH4: domain 1 of 1, from 7 to 33: score 53.8, E = 3.7e-12 *->srldsReLVvDfvsYKLsQnGyeweag<-* s++d+R+LV+Dfv+YKL+Q+Gy+++ag mKIAA0271 7 STPDTRALVADFVGYKLRQKGYVCGAG 33 Bcl-2: domain 1 of 1, from 47 to 145: score 192.5, E = 6.7e-54 *->LrraGdelekrveraFssmsrqlhitpetArelFtqVaeelFeDGgi +r+aGde+e r++r+Fs+++ qlh+tp+ A+++FtqV +elF++ g mKIAA0271 47 MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GP 92 PCPmNWGRiVaLfsFggaLaaklvekemeDVelvsriadwvveFlkenil NWGR+Va+f+Fg+aL+a++v+keme +lv++++dw+v++l+++ l mKIAA0271 93 ----NWGRLVAFFVFGAALCAESVNKEME--PLVGQVQDWMVAYLETR-L 135 aeWiqenGGW<-* a+Wi++ GGW mKIAA0271 136 ADWIHSSGGW 145 //