hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj02648/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0242 ( 194 res) mpj02648 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- UBX UBX domain 94.2 2.5e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- UBX 1/1 1 81 [. 1 90 [] 94.2 2.5e-24 Alignments of top-scoring domains: UBX: domain 1 of 1, from 1 to 81: score 94.2, E = 2.5e-24 *->ekaedvcrlqiRlPDGsRlvrrFnssdtlqdvydfvdshrygadepe +++ +r+q+RlPDGs+++++F+s+++l++ ++f +++ +g+++ + mKIAA0242 1 -DRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQF-AAQTVGNTYGN 45 dYkheFeFsLltpfPrrlltkldesktLkeagllpnstlvlep<-* FsL+t+fPrr++t++d+++ L++++l p++++vl p mKIAA0242 46 -------FSLATMFPRREFTREDYKRRLLDLELAPSASVVLLP 81 //