hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpf/mpf00448/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0239 ( 842 res) mpf00448 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PHD PHD-finger 62.4 9.9e-15 1 C1_1 Phorbol esters/diacylglycerol binding domain -4.5 0.85 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- C1_1 1/1 207 254 .. 1 55 [] -4.5 0.85 PHD 1/1 214 262 .. 1 51 [] 62.4 9.9e-15 Alignments of top-scoring domains: C1_1: domain 1 of 1, from 207 to 254: score -4.5, E = 0.85 *->HhFvhrwnfkqptfCdhCgellwgslgkqGlkCswCklnvHkrChek ++ + Cd+C+++ g g ++ C+ C+++vH+ C+ mKIAA0239 207 -----I-EYDEDVVCDVCRSPE-GEDGNEMVFCDKCNVCVHQACYGI 246 VppeCgcg<-* ++ g + mKIAA0239 247 LKVPTGSW 254 PHD: domain 1 of 1, from 214 to 262: score 62.4, E = 9.9e-15 *->yCsvCgkpdddaggdllqCDgCdrwfHlaClgppleeppegkWlCpe C vC++p +++g+++++CD+C++++H+aC+g+ p+g WlC+ mKIAA0239 214 VCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKV--PTGSWLCRT 258 Ctpk<-* C + mKIAA0239 259 CALG 262 //