hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpf/mpf00455/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0229 ( 1198 res) mpf00455 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ANK ankyrin repeats 166.5 2.7e-45 6 PTB Phosphotyrosine-binding domain, phosphotyros 158.1 9.2e-43 1 SAM Sterile alpha motif. 127.9 1.1e-33 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ANK 1/6 105 134 .. 1 30 [] 34.1 1.9e-05 ANK 2/6 138 167 .. 1 30 [] 28.0 0.0013 ANK 3/6 174 203 .. 1 30 [] 33.3 3.3e-05 ANK 4/6 207 236 .. 1 30 [] 23.3 0.034 ANK 5/6 240 269 .. 1 30 [] 33.5 3e-05 ANK 6/6 272 301 .. 1 30 [] 21.3 0.13 SAM 1/2 718 787 .. 1 67 [] 69.2 5.3e-16 SAM 2/2 792 860 .. 1 67 [] 58.8 6.8e-13 PTB 1/1 962 1096 .. 1 156 [] 158.1 9.2e-43 Alignments of top-scoring domains: ANK: domain 1 of 6, from 105 to 134: score 34.1, E = 1.9e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+TpLH+Aa ng+ +vv+ Ll+++a n+ mKIAA0229 105 TGYTPLHHAALNGHRDVVEVLLRNDALTNV 134 ANK: domain 2 of 6, from 138 to 167: score 28.0, E = 0.0013 *->dGrTpLHlAaengnlevvklLldkgadina<-* G+ pLHlAa +g+ +v+lL++ g++ + mKIAA0229 138 KGCYPLHLAAWKGDAQIVRLLIQQGPSHTR 167 ANK: domain 3 of 6, from 174 to 203: score 33.3, E = 3.3e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* d+ T+LH+Aa++g+ evvk+Ll++ d+++ mKIAA0229 174 DNETALHCAAQYGHTEVVKALLEELTDPTM 203 ANK: domain 4 of 6, from 207 to 236: score 23.3, E = 0.034 *->dGrTpLHlAaengnlevvklLldkgadina<-* TpL lAa +g+levvklLl + +++ mKIAA0229 207 KFETPLDLAALYGRLEVVKLLLGAHPNLLS 236 ANK: domain 5 of 6, from 240 to 269: score 33.5, E = 3e-05 *->dGrTpLHlAaengnlevvklLldkgadina<-* +TpLHlAa+ng++ vv+ Lld+g d n+ mKIAA0229 240 RKHTPLHLAARNGHKAVVQVLLDAGMDSNY 269 ANK: domain 6 of 6, from 272 to 301: score 21.3, E = 0.13 *->dGrTpLHlAaengnlevvklLldkgadina<-* + ++LH Aa g +vv++Ll +g d+n+ mKIAA0229 272 EMGSALHEAALFGKTDVVQILLAAGIDVNI 301 SAM: domain 1 of 2, from 718 to 787: score 69.2, E = 5.3e-16 *->vs.wspesVaeWLesigleqYadnFrkngidgeellllt..seedLk s+ + sV+eWLesigl+qY++ ++ ng+d +l + +e+dL mKIAA0229 718 GSrTLEQSVGEWLESIGLQQYESKLLLNGFDDVRFLGSNvmEEQDLR 764 elGitllGhRkkIlsaiqklkeq<-* e+Gi++++hR+k+l+a ++l + mKIAA0229 765 EIGISDPQHRRKLLQAARSLPKV 787 SAM: domain 2 of 2, from 792 to 860: score 58.8, E = 6.8e-13 *->vs.wspesVaeWLesigleqYadnFrkngidgeellllt.seedLke +++ sp sV WL+s+gl++Y+ F++ g+++ + ++ + ++e+ + mKIAA0229 792 YDgVSPTSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLwELELVNV 838 lGitllGhRkkIlsaiqklkeq<-* l+++llGhRk+I+ ++ + + mKIAA0229 839 LKVHLLGHRKRIIASLADRPYE 860 PTB: domain 1 of 1, from 962 to 1096: score 158.1, E = 9.2e-43 *->segvsfeVkYLGsvevpearkSlapgkglqvlqeairklr...sekk +e + +e+ YLGs+ ++ r g++ q+a++k+r++++++k mKIAA0229 962 FESCGYEANYLGSMLIKDLR-------GTESTQDACAKMRkstEHMK 1001 kpqkvilsvSsdgvklidektkqvlaehplrrIsfcaadpqrwntGgdgs k ++ils++ +gvk id+ +k+v+aeh +r+Is++a+dp mKIAA0229 1002 KIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDP---------- 1041 tdddrvFgyiardpgssgSnrgtsrfaCHVFrcekaa.aedialaigqaF +d+++F+yi++d +s ++ CHVF + +++ +++i+l++gqaF mKIAA0229 1042 -EDLCTFAYITKDLQTS-------HHYCHVFSTVDVNlTYEIILTLGQAF 1083 qvayelklkarse<-* +vay+l+l+a ++ mKIAA0229 1084 EVAYQLALQAQKS 1096 //