hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mbg/mbg05418/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0219 ( 1744 res) mbg05418 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HEAT HEAT repeat 348.3 8.3e-101 26 HEAT_PBS PBS lyase HEAT-like repeat 29.5 7.6e-05 9 Arm Armadillo/beta-catenin-like repeat 15.5 0.95 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Arm 1/3 101 141 .. 1 41 [] 2.6 39 HEAT 1/26 155 186 .. 1 36 [] 9.4 12 HEAT 2/26 227 263 .. 1 36 [] 3.7 75 HEAT_PBS 1/9 263 298 .. 1 27 [] 0.7 5.4e+02 HEAT 3/26 324 360 .. 1 36 [] 2.9 96 HEAT 4/26 362 403 .. 1 36 [] 7.8 20 HEAT_PBS 2/9 388 423 .. 1 27 [] 2.3 3.2e+02 HEAT 5/26 407 443 .. 1 36 [] 7.7 21 HEAT 6/26 444 481 .. 1 36 [] 0.9 1.8e+02 HEAT 7/26 485 522 .. 1 36 [] 6.3 32 HEAT 8/26 527 563 .. 1 36 [] 24.7 0.0022 HEAT 9/26 566 601 .. 1 36 [] 14.1 2.6 HEAT_PBS 3/9 586 622 .. 1 27 [] 0.5 5.6e+02 Arm 2/3 601 640 .. 1 41 [] 2.3 41 HEAT 10/26 606 642 .. 1 36 [] 22.5 0.01 HEAT_PBS 4/9 627 660 .. 1 27 [] 5.8 1e+02 HEAT 11/26 683 719 .. 1 36 [] 22.4 0.011 HEAT_PBS 5/9 704 741 .. 1 27 [] 0.6 5.5e+02 HEAT 12/26 725 761 .. 1 36 [] 30.2 4.7e-05 HEAT_PBS 6/9 746 779 .. 1 27 [] 0.4 5.7e+02 HEAT 13/26 763 800 .. 1 36 [] 1.6 1.5e+02 HEAT 14/26 845 881 .. 1 36 [] 24.6 0.0024 HEAT 15/26 883 919 .. 1 36 [] 25.0 0.0017 HEAT 16/26 993 1029 .. 1 36 [] 19.5 0.081 HEAT_PBS 7/9 1014 1047 .. 1 27 [] 6.7 78 HEAT 17/26 1031 1067 .. 1 36 [] 18.3 0.18 HEAT 18/26 1073 1109 .. 1 36 [] 24.6 0.0024 HEAT_PBS 8/9 1094 1127 .. 1 27 [] 11.4 17 HEAT 19/26 1111 1145 .. 1 36 [] 9.3 12 HEAT 20/26 1220 1255 .. 1 36 [] 4.7 54 HEAT 21/26 1260 1296 .. 1 36 [] 20.2 0.05 HEAT 22/26 1332 1367 .. 1 36 [] 1.1 1.7e+02 HEAT 23/26 1374 1410 .. 1 36 [] 6.9 26 HEAT 24/26 1415 1451 .. 1 36 [] 26.9 0.00047 HEAT_PBS 9/9 1436 1464 .. 1 27 [] 3.9 1.9e+02 Arm 3/3 1489 1528 .. 1 41 [] 12.7 2.1 HEAT 25/26 1494 1530 .. 1 36 [] 25.6 0.0011 HEAT 26/26 1660 1696 .. 1 36 [] 16.1 0.84 Alignments of top-scoring domains: Arm: domain 1 of 3, from 101 to 141: score 2.6, E = 39 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* ++ +++ + l++L + ++++++q A +L+ L+a mKIAA0219 101 DENGPELLPRVAMLRLLTWVIGTGSPRLQVLASDTLTALCA 141 HEAT: domain 1 of 26, from 155 to 186: score 9.4, E = 12 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* e++ +ll +l++p ++VRe+A++ L +l vl mKIAA0219 155 EeVD-----VLLAALQSPCASVRETALRGLMELRLVL 186 HEAT: domain 2 of 26, from 227 to 263: score 3.7, E = 75 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +l+++l ll++ ++ VR+a aeaL++ + + mKIAA0219 227 LdLQSDLCSLLIDDVIYHEAAVRQAGAEALSQAVARY 263 HEAT_PBS: domain 1 of 9, from 263 to 298: score 0.7, E = 5.4e+02 *->vRraAaraLgalgd.........peAipaLleaLed<-* +r Aa+ +g+l +++ ++p +++aL ++ ++ mKIAA0219 263 YQRQAAEVMGRLMEiyqeklyrpPPVLDALGRVISE 298 HEAT: domain 3 of 26, from 324 to 360: score 2.9, E = 96 *->e.lldellplll.kllnDpdpeVReaAaeaLgalaevl<-* ++++ l++++++++lnD +p+VR+ + a a ++ + mKIAA0219 324 SqVK-PLFQFFVpDALNDRNPDVRKCMLDAALATLNAH 360 HEAT: domain 4 of 26, from 362 to 403: score 7.8, E = 20 *->e.lldellplllklln....Dp.dpeVReaAaeaLgalaevl<-* ++ +++llp++ + l++ ++D + + VR++++ +g+la++l mKIAA0219 362 KeNVNSLLPVFEEFLKdapnDAsYDAVRQSVVVLMGSLAKHL 403 HEAT_PBS: domain 2 of 9, from 388 to 423: score 2.3, E = 3.2e+02 *->vRraAaraLgalgd.........peAipaLleaLed<-* vR +++ +g l + ++++++ + ++ L++aL++ mKIAA0219 388 VRQSVVVLMGSLAKhldksdpkvKPIVAKLIAALST 423 HEAT: domain 5 of 26, from 407 to 443: score 7.7, E = 21 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* ++ ++ ++ l+ +l+ p+ V+e++a++L l++ + mKIAA0219 407 DpKVKPIVAKLIAALSTPSQQVQESVASCLPPLVPAV 443 HEAT: domain 6 of 26, from 444 to 481: score 0.9, E = 1.8e+02 *->e.lldellplll.kllnDpdpeVReaAaeaLgalaevl<-* ++ +++ l+++ll+++ + R+ Aa+ L+ l++ l mKIAA0219 444 KeDAGGMIQRLMqQLLESDKYAERKGAAYGLAGLVKGL 481 HEAT: domain 7 of 26, from 485 to 522: score 6.3, E = 32 *->e.lldellplllkllnDp.dpeVReaAaeaLgalaevl<-* + ++e++ +l ++++D+++ + Re A++a+ l+ l mKIAA0219 485 SlKQQEMMAALTDAIQDKkNFRRREGALFAFEMLCTML 522 HEAT: domain 8 of 26, from 527 to 563: score 24.7, E = 0.0022 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* e+++ ++lp+ll +++D + VReaA + a++++l mKIAA0219 527 EpYVVHVLPHLLLCFGDGNQYVREAADDCAKAVMSNL 563 HEAT: domain 9 of 26, from 566 to 601: score 14.1, E = 2.6 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++ +lp ll +l+ ++++ ++ ++e Lga+a ++ mKIAA0219 566 HgVK-LVLPSLLAALEEESWRTKAGSVELLGAMAYCA 601 HEAT_PBS: domain 3 of 9, from 586 to 622: score 0.5, E = 5.6e+02 *->vRraAaraLgalgd..........peAipaLleaLed<-* ++ ++ Lga+ +++ ++ p +p L e+L d mKIAA0219 586 TKAGSVELLGAMAYcapkqlssclPNIVPKLTEVLTD 622 Arm: domain 2 of 3, from 601 to 640: score 2.3, E = 41 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* p++ +++p L + L++++++vq++ AL+ + + mKIAA0219 601 APKQLSSCL-PNIVPKLTEVLTDSHVKVQKAGQQALRQIGS 640 HEAT: domain 10 of 26, from 606 to 642: score 22.5, E = 0.01 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++l++++p l + l+D++ +V++a +aL ++ +v+ mKIAA0219 606 SsCLPNIVPKLTEVLTDSHVKVQKAGQQALRQIGSVI 642 HEAT_PBS: domain 4 of 9, from 627 to 660: score 5.8, E = 1e+02 *->vRraAaraLgalgd.......peAipaLleaLed<-* v+ a +aL+++g+ ++++ + +p+Ll+aL d mKIAA0219 627 VQKAGQQALRQIGSvirnpeiLAIAPVLLDALTD 660 HEAT: domain 11 of 26, from 683 to 719: score 22.4, E = 0.011 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* ++ l ++p+++++++D + + R++Aa+ +g++++ mKIAA0219 683 ApSLALIMPIVQRAFQDRSTDTRKMAAQIIGNMYSLT 719 HEAT_PBS: domain 5 of 9, from 704 to 741: score 0.6, E = 5.5e+02 *->vRraAaraLgalgd...........peAipaLleaLed<-* R Aa+ +g++ + +++++ + p + p L++ L d mKIAA0219 704 TRKMAAQIIGNMYSltdqkdlapylPSVTPGLKASLLD 741 HEAT: domain 12 of 26, from 725 to 761: score 30.2, E = 4.7e-05 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++l+++ p l l Dp+peVR +a+aLga+++ + mKIAA0219 725 ApYLPSVTPGLKASLLDPVPEVRTVSAKALGAMVKGM 761 HEAT_PBS: domain 6 of 9, from 746 to 779: score 0.4, E = 5.7e+02 *->vRraAaraLgalgd.......peAipaLleaLed<-* vR a+aLga+ + +++ ++ +p L+e L mKIAA0219 746 VRTVSAKALGAMVKgmgescfEDLLPWLMETLTY 779 HEAT: domain 13 of 26, from 763 to 800: score 1.6, E = 1.5e+02 *->e.lldellplllkllnDpdpeV.ReaAaeaLgalaevl<-* e++ ++llp l++ l+ + ++V+R Aa+ L++++ l mKIAA0219 763 EsCFEDLLPWLMETLTYEQSSVdRSGAAQGLAEVMAGL 800 HEAT: domain 14 of 26, from 845 to 881: score 24.6, E = 0.0024 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++ ++p++lk+l D+++ VR++A++a +++++ + mKIAA0219 845 TpYVGPIIPCILKALADENEFVRDTALRAGQRVISMY 881 HEAT: domain 15 of 26, from 883 to 919: score 25.0, E = 0.0017 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* e+++ llp l ++l D+ +++R ++++ Lg+l+ ++ mKIAA0219 883 EtAIALLLPQLEQGLFDDLWRIRFSSVQLLGDLLFHI 919 HEAT: domain 16 of 26, from 993 to 1029: score 19.5, E = 0.081 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++l++l+ lll l ++ ++ R Aa++Lg+l+++l mKIAA0219 993 ReILPTLFGLLLGFLASTCADKRTIAARTLGDLVRKL 1029 HEAT_PBS: domain 7 of 9, from 1014 to 1047: score 6.7, E = 78 *->vRraAaraLgalgd.......peAipaLleaLed<-* R Aar Lg l + +++ pe ip+L e L++ mKIAA0219 1014 KRTIAARTLGDLVRklgekilPEIIPILEEGLRS 1047 HEAT: domain 17 of 26, from 1031 to 1067: score 18.3, E = 0.18 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* e++l+e++p+l ++l+++ ++ R+ ++ L+++++ mKIAA0219 1031 EkILPEIIPILEEGLRSQKSDERQGVCIGLSEIMKST 1067 HEAT: domain 18 of 26, from 1073 to 1109: score 24.6, E = 0.0024 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* + ++l+p+ k+l+Dp +eVReaAa+++ +l + + mKIAA0219 1073 LfFSESLVPTARKALCDPLEEVREAAAKTFEQLHSTI 1109 HEAT_PBS: domain 8 of 9, from 1094 to 1127: score 11.4, E = 17 *->vRraAaraLgalgd.......peAipaLleaLed<-* vR+aAa+ +l ++ +++ ++ +p Ll+ L+d mKIAA0219 1094 VREAAAKTFEQLHStighqalEDILPFLLKQLDD 1127 HEAT: domain 19 of 26, from 1111 to 1145: score 9.3, E = 12 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* ++l+++lp+llk l+D++ V e A+ L +++ v mKIAA0219 1111 HqALEDILPFLLKQLDDEE--VSEFALDGLKQVMAVK 1145 HEAT: domain 20 of 26, from 1220 to 1255: score 4.7, E = 54 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++ +++ ll++ ++p+ R+aAa L ++ mKIAA0219 1220 TgHR-IIIEDLLEATRSPEVGMRQAAAIILNMYCSRS 1255 HEAT: domain 21 of 26, from 1260 to 1296: score 20.2, E = 0.05 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++l +l+ l++l+nD++p V e + aL a+ ++l mKIAA0219 1260 SsHLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKL 1296 HEAT: domain 22 of 26, from 1332 to 1367: score 1.1, E = 1.7e+02 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++ ++lp+l ++ +pe +e Aa+ Lg +++ mKIAA0219 1332 RgVT-SILPVLREGVLTGSPEQKEEAAKGLGLVIRLT 1367 HEAT: domain 23 of 26, from 1374 to 1410: score 6.9, E = 26 *->e.lldellplllkllnDp.dpeVReaAaeaLgalaevl<-* +++ ++ +l++ l+D ++ V++a +e+L+ l+ ++ mKIAA0219 1374 PsVV-SITGPLIRILGDRfNWTVKAALLETLSLLLGKV 1410 HEAT: domain 24 of 26, from 1415 to 1451: score 26.9, E = 0.00047 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* +++l++l ++ k+l+D++ VR+ Aa aLg+l++++ mKIAA0219 1415 KpFLPQLQTTFTKALQDSNRGVRLKAADALGKLISIH 1451 HEAT_PBS: domain 9 of 9, from 1436 to 1464: score 3.9, E = 1.9e+02 *->vRraAaraLgalgd..peAipaLleaLed<-* vR Aa aLg+l + + + p+ e+L+ mKIAA0219 1436 VRLKAADALGKLISihVKVDPLFTELLNG 1464 Arm: domain 3 of 3, from 1489 to 1528: score 12.7, E = 2.1 *->npenkqavveaGalppLvqLLsspdeevqeeAawALsNLaa<-* ++ a+++ + +L+++L +++ +++ a++L+ L+a mKIAA0219 1489 GSKVDAAIRKN-LVSLLLSMLGHDEDNTRISTAGCLGELCA 1528 HEAT: domain 25 of 26, from 1494 to 1530: score 25.6, E = 0.0011 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* + ++++l+ lll++l++++++ R ++a +Lg+l+ +l mKIAA0219 1494 AaIRKNLVSLLLSMLGHDEDNTRISTAGCLGELCAFL 1530 HEAT: domain 26 of 26, from 1660 to 1696: score 16.1, E = 0.84 *->e.lldellplllkllnDpdpeVReaAaeaLgalaevl<-* ++++ +l +ll+ +D++ VR+ + +a+++l++ mKIAA0219 1660 PqTIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMR 1696 //