hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mib/mib33003/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0126 ( 1030 res) mib33003 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- U-box U-box domain 171.6 1.3e-47 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- U-box 1/1 951 1025 .. 1 81 [] 171.6 1.3e-47 Alignments of top-scoring domains: U-box: domain 1 of 1, from 951 to 1025: score 171.6, E = 1.3e-47 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt D++DEFlDPI+++LM DPV+lPS+++t+DRstI+rHLls d+t mKIAA0126 951 DACDEFLDPIMSTLMSDPVVLPSSRVTVDRSTIARHLLS-----DQT 992 DPftGRepLthdeliPNleLKekIdafleekrea<-* DPf+ R+pLt+d++ PN eLKekI+++l+e++++ mKIAA0126 993 DPFN-RSPLTMDQIRPNTELKEKIQRWLAERKQQ 1025 //