hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj03178/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0124 ( 737 res) mpj03178 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- BOP1NT BOP1NT (NUC169) domain 630.3 1.1e-185 1 WD40 WD domain, G-beta repeat 151.8 1.2e-41 6 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- BOP1NT 1/1 135 393 .. 1 267 [] 630.3 1.1e-185 WD40 1/6 395 432 .. 1 38 [] 49.9 5.5e-11 WD40 2/6 437 474 .. 1 38 [] 7.4 25 WD40 3/6 562 597 .. 1 38 [] 20.7 0.035 WD40 4/6 602 639 .. 1 38 [] 18.3 0.18 WD40 5/6 645 682 .. 1 38 [] 34.6 2.2e-06 WD40 6/6 700 737 .] 1 38 [] 27.4 0.00034 Alignments of top-scoring domains: BOP1NT: domain 1 of 1, from 135 to 393: score 630.3, E = 1.1e-185 *->YDeypHIGYDIdGKKImKparg.daLDdfLdsiddpdgWRgikDkkT YDe+pH+GYD+dGK+I+Kp r++d+LD+fLd++ddpd+WR+++Dk+T mKIAA0124 135 YDEFPHVGYDLDGKRIYKPLRTrDELDQFLDKMDDPDFWRTVQDKMT 181 GqdVnLTDEeleLIkRiqkgeipdenidPYepiiewFtseteimPlsaaP G+d++LTDE+++L++R+q+g+++d+ ++PYep++++F+++++i+P++++P mKIAA0124 182 GRDLRLTDEQVALVHRLQRGQFGDSGFNPYEPAVDFFSGDIMIHPVTNRP 231 epKRrFvPSkhEkKKVsKlVhAIrmGwikppekpkereeeekeepkfYDL ++KR+F+ S++Ek+KVs++VhAI+mGwikp ++p++ + p+fYDL mKIAA0124 232 ADKRSFILSLVEKEKVSRMVHAIKMGWIKP-RRPHDPT------PSFYDL 274 WadddsnatdeerhlmhipAPKlpLPGHeeSYNPPpEYLpteeEkkeWlk Wa++d+na+ + rh+mh+pAPKl+LPGH+eSYNPPpEYLpteeE+++W++ mKIAA0124 275 WAQEDPNAVLG-RHKMHVPAPKLALPGHAESYNPPPEYLPTEEERSAWMQ 323 LlePeeRkrnFiPqKyksLRkVPaYsrfirERFeRCLDLYLcPRvRKnrL +eP+eRk+nF+PqK++sLR+VPaYsrfi+ERFeRCLDLYLcPR+RK+r+ mKIAA0124 324 -QEPVERKLNFLPQKFPSLRTVPAYSRFIQERFERCLDLYLCPRQRKMRV 372 NIDpEsLiPKLPsPkDLqPFP<-* N+DpE+LiPKLP+P+DLqPFP mKIAA0124 373 NVDPEDLIPKLPRPRDLQPFP 393 WD40: domain 1 of 6, from 395 to 432: score 49.9, E = 5.5e-11 *->eclavl.gHtspVtcvafspdsgpllasgSrDgtikiWd<-* ++ v++gH++ V+c+++sp g++lasgS+Dgt+k+W+ mKIAA0124 395 CQALVYrGHSDLVRCLSVSPG-GQWLASGSDDGTLKLWE 432 WD40: domain 2 of 6, from 437 to 474: score 7.4, E = 25 *->eclavl.gHtspVtcvafspdsgpllasgSrDgtikiWd<-* c ++ + + V+++a++p++ +l+ + D + + + mKIAA0124 437 RCMKTVhVG-GVVRSIAWNPNPTICLVAAAMDDAVLLLN 474 WD40: domain 3 of 6, from 562 to 597: score 20.7, E = 0.035 *->eclavl.gHtspVtcvafspdsgpllasgSrDgtikiWd<-* + + H + V cvaf+p+ +p+l+ +S ++i+i++ mKIAA0124 562 SQSPFRrSH-GQVQCVAFHPS-RPFLLVASQ-RSIRIYH 597 WD40: domain 4 of 6, from 602 to 639: score 18.3, E = 0.18 *->eclavl.gHtspVtcvafspdsgpllasgSrDgtikiWd<-* e+++ l ++V+++a++p g +++gS D ++ +d mKIAA0124 602 ELTKKLmPNCKWVSSMAVHPA-GDNIICGSYDSKLVWFD 639 WD40: domain 5 of 6, from 645 to 682: score 34.6, E = 2.2e-06 *->eclavl.gHtspVtcvafspdsgpllasgSrDgtikiWd<-* ++ +vl++H+++ ++vaf+p +pl+asgS+Dg++ + + mKIAA0124 645 KPYKVLrHHKKALRAVAFHPR-YPLFASGSDDGSVIVCH 682 WD40: domain 6 of 6, from 700 to 737: score 27.4, E = 0.00034 *->eclavl.gHtspVtcvafspdsgpllasgSrDgtikiWd<-* ++ + +V +vaf+p +p+++s+++Dgti++++ mKIAA0124 700 VLKGHTlTRDLGVLDVAFHPT-QPWVFSSGADGTIRLFS 737 //