hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/msj/msj01112/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0112 ( 373 res) msj01112 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RRS1 Ribosome biogenesis regulatory protein (RRS1 409.3 3.7e-119 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RRS1 1/1 30 205 .. 1 198 [] 409.3 3.7e-119 Alignments of top-scoring domains: RRS1: domain 1 of 1, from 30 to 205: score 409.3, E = 3.7e-119 *->ksitVEkeielqfDLGNLLafDrNpldelrlsdadssrgekeeeLks ++itV+ke+el fDLGNLLa+DrNp+++lr +++ + +++ L + mKIAA0112 30 QRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSP--EAE---LRA 71 laRdNvQlLvNklwsLPterveEgiGGtGGqssvmtivqLPePTTrLPRe laRdN+QlL+N+lw LPterveE++ +++LPeP TrLPRe mKIAA0112 72 LARDNTQLLINQLWRLPTERVEEAV-----------VARLPEPATRLPRE 110 KpLPkPKPlTKWEkFArkKGIkkKKKeGKlVyDEasgeWvPkwGYkRank KpLP+P+PlT+W++FAr+KGI++KKK+ +lV+DEasg+W+++wGYkRa+ mKIAA0112 111 KPLPRPRPLTRWQQFARLKGIRPKKKT-NLVWDEASGQWRRRWGYKRAR- 158 ddtkdWLiEvpdnaKGtddPlvDpFakridkkKerVaKNEknRlkNlkrA ddtk+WLiEvp++a dP +D+Fakr ++kKerVaKNE+nRl+Nl+rA mKIAA0112 159 DDTKEWLIEVPGSA----DPMEDQFAKRTQAKKERVAKNELNRLRNLARA 204 e<-* + mKIAA0112 205 H 205 //