hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/smart.HMMs
Sequence file:            /cdna4/rodent/full/goal/mph/mph00974/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0082  ( 690 res)   mph00974

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
WW                                                       33.3    3.3e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
WW         1/1     610   643 ..     1    34 []    33.3  3.3e-05

Alignments of top-scoring domains:
WW: domain 1 of 1, from 610 to 643: score 33.3, E = 3.3e-05
                   *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-*
                      +++++W++ ++++++r+++yN++T+++ +  P+e   
   mKIAA0082   610    TVNEPWTMGFSKSNNRKFFYNKKTQKSVYALPTE    643  

//