hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data11/genetics/InterProScan/iprscan/data/Pfam
Sequence file:            /cdna4/rodent/full/goal/mbj/mbj00238/w3open/interpro/cnk_1/seq.in
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  mKIAA0078  ( 426 res)   mbj00238

Scores for sequence family classification (score includes all domains):
Model      Description                                  Score    E-value  N 
--------   -----------                                  -----    ------- ---
Rad21_Rec8 Conserved region of Rad21 / Rec8 like prot   104.7    1.8e-27   1

Parsed for domains:
Model      Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------   ------- ----- -----    ----- -----      -----  -------
Rad21_Rec8   1/1     369   423 ..     1    55 []   104.7  1.8e-27

Alignments of top-scoring domains:
Rad21_Rec8: domain 1 of 1, from 369 to 423: score 104.7, E = 1.8e-27
                   *->tegeklslsqLpagttRkeAArlFYelLVLktegaIdVkQeePYgdI
                      t+ e++sl++L+++t+Rk+AA++FY++LVLk+++aI+++QeePY+dI
   mKIAA0078   369    TGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDI 415  

                   likagPkl<-*
                   + ++gP++   
   mKIAA0078   416 IATPGPRF    423  

//