hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj03270/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0064 ( 502 res) mpj03270 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PX PX domain 97.1 3.6e-25 1 RA Ras association (RalGDS/AF-6) domain 7.9 0.98 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PX 1/1 33 137 .. 1 133 [] 97.1 3.6e-25 RA 1/1 147 238 .. 1 98 [] 7.9 0.98 Alignments of top-scoring domains: PX: domain 1 of 1, from 33 to 137: score 97.1, E = 3.6e-25 *->dsili.vvvvdpetsrkkegskkhtyyvyeittktnkewsVkRRYsd ++++i+ +++++ s ++ +y++y+i++++ +++ RYs+ mKIAA0064 33 MHFSIpETESRSGDS------GGSAYVAYNIHVNG--VLHCRVRYSQ 71 FeeLhekLlrkfpalgrilPplPpKklfgryrkeslemtsvkhssnnfde + Lhe+L+++++ + ++P +PpKklf+ + + mKIAA0064 72 LLGLHEQLRKEYG--ANVVPAFPPKKLFS------------------LTP 101 efiekRrkgLeeyLqrllqhPelsnesevvleFLesd<-* + +e+Rr++Le+y+q + q+P+l + se + +FL mKIAA0064 102 AEVEQRREQLEKYMQAVRQDPLLGS-SETFNSFLRRA 137 RA: domain 1 of 1, from 147 to 238: score 7.9, E = 0.98 *->dsgvlrVygedgtpgtyktilvskntTaeeViralLrKfgldaddpe + l V + +g+ + + v ++ +e+V++a++ K+ l++d + mKIAA0064 147 EEVSLEVLLSNGQ---KVLVTVLTSDQTEDVLEAVAAKLDLPDDLIG 190 dyvLvEvslvlerggeer.....rvLpddEkPlqiqlqlkrdaqvrsrFl +++L +l+r+ e+ + r+L + E P+ + l+++ + ++ mKIAA0064 191 YFSL-----FLVREKEDGafsfvRKLQEFELPYVSVTSLRSQ---EYKIV 232 Lrrred<-* Lr+ mKIAA0064 233 LRKSYW 238 //