hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpj/mpj00603/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0035 ( 703 res) mpj00603 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SRP40_C SRP40, C-terminal domain 210.4 2.8e-59 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SRP40_C 1/1 605 700 .. 1 99 [] 210.4 2.8e-59 Alignments of top-scoring domains: SRP40_C: domain 1 of 1, from 605 to 700: score 210.4, E = 2.8e-59 *->kkskskstntepakvdknskrkkkPFrRVdeekqiifvserlrDNsf kk+k+ ++nt+p k++k+++r+++PFrRV+ee+ i+v++r++DNsf mKIAA0035 605 KKVKLETPNTFP-KRKKGERRASSPFRRVREEE--IEVDSRVADNSF 648 dskaGAegdWGekANevLgkvrGKdFRhEKTKKKRGSYRGGsInqevnSi d+k+GA+gdWGe+AN+vL++++GK+FRhEKTKKKRGSYRGGsI+++vnS+ mKIAA0035 649 DAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSV 698 KF<-* KF mKIAA0035 699 KF 700 //