hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mbh/mbh01716/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0021 ( 853 res) mbh01716 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DISIN Homologues of snake disintegrins 152.4 4.6e-41 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DISIN 1/1 431 507 .. 1 81 [] 152.4 4.6e-41 Alignments of top-scoring domains: DISIN: domain 1 of 1, from 431 to 507: score 152.4, E = 4.6e-41 *->EeGEECDCGspkeeCrttdpCCdpaTCkLkpgaqCadsGpCCekdCk ++GEECDCG+ k eC + dpCC+++TCkLk++a+Ca +G+CC+ dC+ mKIAA0021 431 DPGEECDCGTAK-EC-EVDPCCEGSTCKLKSFAECA-YGDCCK-DCQ 473 fkpaGtlCRpsvdeCDlpEYCnGtSaeCPpDvyv<-* f p G +CR +++eCD+pEYCnG+S +CPpDv++ mKIAA0021 474 FLPGGSMCRGKTSECDVPEYCNGSSQFCPPDVFI 507 //