hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mfj/mfj00709/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0018 ( 559 res) mfj00709 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FAD_binding_4 FAD binding domain 22.1 0.00033 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FAD_binding_4 1/1 107 246 .. 1 144 [] 22.1 0.00033 Alignments of top-scoring domains: FAD_binding_4: domain 1 of 1, from 107 to 246: score 22.1, E = 0.00033 *->P.aavvrPeseeevaaivrlArehgipvtprGgGhslsfGgavplnt P++ r+++++ ++ ++ + + t r g +s+ + + mKIAA0018 107 PrLHEQRVRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYK-K 152 gG..vvldlsrrlnriileiDpetdgtatveaGvtl.dLnralaahGlfl ++++++l ++ ile+D + +++ve+ v ++++ + l+ G++l mKIAA0018 153 THknIMINL---MD--ILEVDTK-KQIVRVEPLVSMgQVTALLNSIGWTL 196 pldpgsgipgtvGGaiatnagGygsekyGltrdnvlglevVladGevvrl p+ p + tvGG+i + ++ + s+kyGl+ + +++ e++ladG+ vr+ mKIAA0018 197 PVLPELDDL-TVGGLIMGTGIESSSHKYGLFQHICTAYELILADGSFVRC 245 s<-* + mKIAA0018 246 T 246 //