hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/smart.HMMs Sequence file: /cdna4/rodent/full/goal/mpf/mpf00884/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0013 ( 1049 res) mpf00884 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP GTPase-activator protein for Rho-like GTPase 172.8 3.5e-47 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RhoGAP 1/1 125 298 .. 1 193 [] 172.8 3.5e-47 Alignments of top-scoring domains: RhoGAP: domain 1 of 1, from 125 to 298: score 172.8, E = 3.5e-47 *->spiPiivekCieylekrGldteGIYRvsGsksrvkeLreafdsgedd ++iP++++ +++ l++ ++teG++R+sGs+ r+k+L++++d+ge mKIAA0013 125 GHIPSFLVDACASLKE-HIHTEGLFRKSGSVVRLKALKSKLDQGEA- 169 ldsldesiteesedleeydvhdvAglLKlyLReLPePLltfelyeefiea +l+++ + dvAglLK+++ReLPeP+l+ +l+e + +a mKIAA0013 170 -------------CLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFKA 206 aklyqieatsrkqseksedeeerlralrellslLPpanratLryLl.HLn + eer +a ++l +l + + Lry +++L+ mKIAA0013 207 QQ---------------LGAEERNKATLLLSCLMANPTVDILRYFFnFLK 241 rVaehsevNkMtarNLAivFgPtLlrpp..........ltdikhqnkvve V+ +++NkM+++NLA++F+P+Ll+ ++++++ + ++++ ++q++vv+ mKIAA0013 242 SVSLRASENKMDSSNLAVIFAPNLLQTSeghekmsantEKKLRLQAAVVQ 291 tlienad<-* t+i+ a mKIAA0013 292 TFIDCAS 298 //