hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data11/genetics/InterProScan/iprscan/data/Pfam Sequence file: /cdna4/rodent/full/goal/mpf/mpf00884/w3open/interpro/cnk_1/seq.in - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: mKIAA0013 ( 1049 res) mpf00884 Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RhoGAP RhoGAP domain 167.1 3e-46 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RhoGAP 1/1 128 274 .. 1 155 [] 167.1 3e-46 Alignments of top-scoring domains: RhoGAP: domain 1 of 1, from 128 to 274: score 167.1, E = 3e-46 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdln P ++++ ++ l+++ ++tEG++R+sGs+ r+k+L+ ++d+ge+ mKIAA0013 128 PSFLVDACASLKEH-IHTEGLFRKSGSVVRLKALKSKLDQGEA---- 169 dleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerlea +l+ + +vA+lLK+F+ReLPeP+l+ +l+e++++ a+++ ee +a mKIAA0013 170 CLSSALPCDVAGLLKQFFRELPEPVLPADLHEALFK-AQQLGAEERN-KA 217 lrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLlr +l +++ + d Lry + +L+ V+ ++++NkM+++NLA++F+P+Ll+ mKIAA0013 218 TLLLSCLMANPTVDILRYFFNFLKSVSLRASENKMDSSNLAVIFAPNLLQ 267 ppdgdsad<-* +++g + mKIAA0013 268 TSEG-HEK 274 //